Invitrogen™ Human GPR150 (aa 358-434) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89583	100 μL

Catalog No. RP89583 Supplier Invitrogen™ Supplier No. RP89583

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110920. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled receptors (GPCRs), also designated seven transmembrane (7TM) receptors and heptahelical receptors, are a protein family which interact with G proteins (heterotrimeric GTPases) to synthesize intracellular second messengers such as diacylglycerol, cyclic AMP, inositol phosphates, and calcium ions. Their diverse biological functions range from vision and olfaction to neuronal and endocrine signaling and are involved in many pathological conditions. G protein receptor 150 (GPR150), also designated PGR11 and seven transmembrane helix receptor, is a member of the rhodopsin family of GCPRs and is involved in signal transduction. GPR150 is expressed in various human tissues, including normal small intestine, skeletal muscle, kidney and tonsil, as well as cancerous blood, bladder, placenta and parathyroid.

Specifications

• Accession Number: Q8NGU9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 285601
• Name: Human GPR150 (aa 358-434) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C030001A19Rik; G protein-coupled receptor 150; Gpr150; G-protein coupled receptor PGR11; GPRv40; Pgr11; probable G-protein coupled receptor 150; RGD1564729; seven transmembrane helix receptor
• Common Name: GPR150
• Gene Symbol: GPR150
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPPPRPRPLPCSCESAF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining