Invitrogen™ Human GPR157 (aa 192-226) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP110246	100 μL

Catalog No. RP110246 Supplier Invitrogen™ Supplier No. RP110246

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144851. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Orphan receptor that promotes neuronal differentiation of radial glial progenitors (RGPs). The activity of this receptor is mediated by a G(q)-protein that activates a phosphatidylinositol-calcium second messenger.

Specifications

• Accession Number: Q5UAW9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80045
• Name: Human GPR157 (aa 192-226) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: F730108M23Rik; FLJ12132; G protein-coupled receptor 157; GPR157; G-protein coupled receptor 157; novel 7 transmembrane receptor (Secretin family) domain containing protein; probable G-protein coupled receptor 157
• Common Name: GPR157
• Gene Symbol: GPR157
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRKHINRAHTALSEYRPILSQEHRLLRHSSMADKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining