Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human GPR176 (aa 423-507) Control Fragment Recombinant Protein

Catalog No. RP102880
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102880 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102880 Supplier Invitrogen™ Supplier No. RP102880
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59018. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled receptors (GPRs), also known as seven transmembrane receptors, heptahelical receptors or 7TM receptors, comprise a superfamily of proteins that play a role in many different stimulus-response pathways. G protein coupled receptors translate extracellular signals into intracellular signals (G protein activation) and they respond to a variety of signaling molecules, such as hormones and neurotransmitters. GPR176 (G protein-coupled receptor 176), also known as HB-954, GPR or Gm1012, is a 515 amino acid multi-pass membrane protein belonging to the G-protein coupled receptor 1 family. Expressed in brain and spleen, with trace expression in kidney, GPR176 functions as an orphan receptor that is thought to play a role in signaling events throughout the cell. Containing four N-glycosylation sites, seven transmembrane domains and a large C-terminal cytosolic domain, GPR176 is encoded by a gene mapping to human chromosome 15q14.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14439
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 11245
Name Human GPR176 (aa 423-507) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias Agr9; G protein-coupled receptor 176; Gm1012; Gpr; GPR176; G-protein coupled receptor 176; G-protein coupled receptor AGR9; HB954; HB-954; probable G-protein coupled receptor 176; putative G protein coupled receptor; RBU-15
Common Name GPR176
Gene Symbol GPR176
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTKVPKVGRVERKMSRNNKV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.