Invitrogen™ Human GRIK1 (aa 400-449) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109925	100 μL

Catalog No. RP109925 Supplier Invitrogen™ Supplier No. RP109925

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145060. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. Grik1, also known as glutamate receptor 5, belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. Grik1 is expressed in GABAergic interneurons of the hippocampus and are thought to participate in the formation of various subtypes of kainate receptors with Grik2 and KA2. Stimulation of Grik1 leads to intracellular calcium release and activation of protein kinase C. Excessive activation has been associated with psychiatric, neurological and neurodegenerative diseases. Numerous isoforms of Grik1 are known to exist and may be subject to RNA editing within the second transmembrane domain, which is thought to alter the properties of ion flow.

Specifications

• Accession Number: P39086
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2897
• Name: Human GRIK1 (aa 400-449) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A830007B11Rik; D16Ium24; D16Ium24e; EAA3; EEA3; excitatory amino acid receptor 3; GLR5; GluK1; GluK5; GLUR5; gluR-5; Glurbeta1; glutamate ionotropic receptor kainate type subunit 1; glutamate receptor; glutamate receptor 5; Glutamate receptor ionotropic, kainate 1; glutamate receptor subunit 5; glutamate receptor, ionotropic, kainate 1; GRIK1
• Common Name: GRIK1
• Gene Symbol: Grik1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining