Invitrogen™ Human GRK1 (aa 1-79) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105898	100 μL

Catalog No. RP105898 Supplier Invitrogen™ Supplier No. RP105898

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65142. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRK1 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinases. GRK1 mediates rapid desensitization of rod photoreceptors to light by catalyzing phosphorylation of the visual pigment rhodopsin which leads to its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). GRK1 can be phosphorylated by PKA and this reduces the ability of GRK1 to phosphorylate rhodopsin in vitro. It is speculated that phosphorylation of GRK1 by PKA in vivo occurs in the dark when cAMP levels in photoreceptor cells are elevated.

Specifications

• Accession Number: Q15835
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6011
• Name: Human GRK1 (aa 1-79) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: G protein-coupled receptor kinase 1; G protein-coupled receptpr kinase 1; GPRK1; G-protein coupled receptor kinase 1; G-protein receptor kinase 1; GRK 1a/b; GRK1; GRK1a; rhodopsin kinase; rhodopsin kinase GRK1; Rhok; RK
• Common Name: GRK1
• Gene Symbol: GRK1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining