Invitrogen™ Human Growth Hormone Receptor (aa 156-257) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106086	100 μL

Catalog No. RP106086 Supplier Invitrogen™ Supplier No. RP106086

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65404. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Growth hormone receptor (GHR) is a gene located on chromosome 5p13.1, encoding a transmembrane receptor that plays a critical role in mediating the effects of growth hormone, which is crucial for growth, metabolism, and tissue development. GHR is expressed in various tissues, including the liver, muscle, and adipose tissue, and facilitates the growth hormone signaling pathway by binding to growth hormone, leading to receptor dimerization and activation of intracellular signaling cascades such as the JAK2-STAT5 pathway. This signaling promotes growth and anabolic processes, influencing body composition, insulin sensitivity, and lipid metabolism. Mutations or alterations in the GHR gene can lead to growth disorders like Laron syndrome, characterized by insensitivity to growth hormone. Understanding GHR's structure and function is pivotal for developing therapeutic strategies for growth deficiencies and metabolic syndromes, as modifying GHR signaling pathways can offer potential interventions in related conditions.

Specifications

• Accession Number: P10912
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2690
• Name: Human Growth Hormone Receptor (aa 156-257) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: GH receptor; GH-binding protein; GHBP; GHIP; GHR; GHR/BP; growth hormone binding protein; growth hormone receptor; growth hormone receptor precursor; Growth hormone receptor precursor (GH receptor) (GH binding protein) (GHBP) (Serum binding protein); growth hormone receptor precursor splice variant D56; growth hormone receptor variant d5-6; growth hormone receptor/binding protein; Growth hormone-binding protein; MGC124963; MGC156665; serum binding protein; Serum-binding protein; Somatotropin receptor; unnamed protein product
• Common Name: Growth Hormone Receptor
• Gene Symbol: GHR
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining