Invitrogen™ Human GTF2E1 (aa 39-169) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107526	100 μL

Catalog No. RP107526 Supplier Invitrogen™ Supplier No. RP107526

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66877. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation together with RNA polymerase II and other general factors. Human TFIIE consists of two subunits of relative molecular mass 57, 000 (TFIIE-alpha) and 34, 000 (TFIIE-beta) and joins the preinitiation complex after RNA polymerase II and TFIIF. TFIIE-alpha is necessary for transcription initiation together with TFIIE-beta, and recombinant TFIIE-alpha can fully replace the natural subunit in an in vitro transcription assay. Its sequence contains several interesting structural motifs (leucine repeat, zinc finger and helix-turn-helix) and sequence similarities to bacterial sigma factors that suggest direct involvement in the regulation of transcription initiation.

Specifications

• Accession Number: P29083
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2960
• Name: Human GTF2E1 (aa 39-169) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610024P03Rik; 56kDa; AI303800; FE; general transcription factor II E, polypeptide 1 (alpha subunit); general transcription factor II E, polypeptide 1 (alpha subunit, 56kDa); general transcription factor IIE 56 kDa subunit; General transcription factor IIE subunit 1; General transcription factor IIE subunit 1-like protein; general transcription factor IIE, polypeptide 1 (alpha subunit); general transcription factor IIE, polypeptide 1 (alpha subunit, 56kDa); general transcription factor IIE, polypeptide 1, alpha; general transcription factor IIE, polypeptide 1, alpha 56kDa; GTF2E1; TF2E1; TFIIE alpha subunit; TFIIE-A; TFIIE-alpha; Transcription initiation factor IIE subunit alpha
• Common Name: GTF2E1
• Gene Symbol: GTF2E1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining