Invitrogen™ Human GUCY1A3 (aa 164-236) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104186	100 μL

Catalog No. RP104186 Supplier Invitrogen™ Supplier No. RP104186

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Guanylate cyclases belong to the adenylyl cyclase class-4/guanylyl cyclase family. There are two forms of guanylate cyclase, a soluble form (GCS or sGC), which act as receptors for nitric oxide and a membrane-bound receptor form (GC), which are peptide hormone receptors. The GC-C protein is composed of an extracellular domain, a single transmembrane domain, and a cytoplasmic region consisting of a kinase-like domain and a catalytic domain. It is expressed as two differentially glycosylated forms, a 130 kDa precursor form present in the endoplasmic reticulum and a 145 kDa form present on the plasma membrane. Ligand binding to the extracellular domain of GC-C promotes the accumulation of cGMP. GC-C acts as the receptor for heatstable enterotoxins, small peptides secreted by some pathogenic strains of E. coli that cause severe secretory diarrhea. GC-C also binds to guanylin and uroguanylin peptides, which modulate renal function in response to oral salt load.

Specifications

• Accession Number: Q02108
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2982
• Name: Human GUCY1A3 (aa 164-236) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200016O07Rik; 4.6.1.2; alpha 1 sGC; GC-SA3; GCSalpha1; GC-S-alpha-1; GCS-alpha1; GCS-alpha-1; GCS-alpha-3; guanylate cyclase 1 soluble subunit alpha; guanylate cyclase 1, soluble, alpha 3; Guanylate cyclase soluble alpha 1 (GTP pyrophosphate - lyase); Guanylate cyclase soluble subunit alpha-1; Guanylate cyclase soluble subunit alpha-3; Guanylate cyclase, soluble, alpha 1 (GTP pyrophosphate - lyase); GUC1A3; GUCA3; GUCSA3; Gucy1a1; GUCY1A3; MYMY6; SGC; sGC-alpha1; soluble guanylate cyclase large subunit
• Common Name: GUCY1A3
• Gene Symbol: GUCY1A1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining