Invitrogen™ Human GUCY2C (aa 982-1067) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96527	100 μL

Catalog No. RP96527 Supplier Invitrogen™ Supplier No. RP96527

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58043. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin.

Specifications

• Accession Number: P25092
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2984
• Name: Human GUCY2C (aa 982-1067) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI893437; DIAR6; Gcc; GC-C; guanylate cyclase 2C; guanylyl cyclase C; GUC2C; GUCY2C; heat stable enterotoxin receptor; heat-stable enterotoxin receptor; hSTAR; intestinal guanylate cyclase; MECIL; MUCIL; STA receptor; STAR
• Common Name: GUCY2C
• Gene Symbol: GUCY2C
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining