Invitrogen™ Human HABP4 (aa 280-347) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109019	100 μL

Catalog No. RP109019 Supplier Invitrogen™ Supplier No. RP109019

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140105. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA-binding protein that plays a role in the regulation of transcription, pre-mRNA splicing and mRNA translation (PubMed:14699138, PubMed:16455055, PubMed:19523114, PubMed:21771594). Negatively regulates DNA-binding activity of the transcription factor MEF2C in myocardial cells in response to mechanical stress. Plays a role in pre-mRNA splicing regulation (PubMed:19523114). Binds (via C-terminus) to poly(U) RNA (PubMed:19523114). Involved in mRNA translation regulation, probably at the initiation step (PubMed:21771594). Seems to play a role in PML-nuclear bodies formation (PubMed:28695742). [UniProt].

Specifications

• Accession Number: Q5JVS0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 22927
• Name: Human HABP4 (aa 280-347) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4933413D03Rik; 4933428J01Rik; chromodomain helicase DNA binding protein 3 interacting protein; habp4; hyaluronan binding protein 4; Hyaluronan-binding protein 4; hyaluronic acid binding protein 4; Hyaluronic acid-binding protein 4; hyaluronic acid-binding protein 4 (intracellular); IHABP4; IHABP-4; intracellular antigen detected by monoclonal antibody Ki-1; intracellular hyaluronan-binding protein 4; intracellular hyaluronan-binding protein p57; Ki-1/57; ki-1/57 intracellular antigen; SERBP1L
• Common Name: HABP4
• Gene Symbol: HABP4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEVEEETQVQEMTLDEWKNLQEQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining