Invitrogen™ Human HADH (aa 133-219) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104782	100 μL

Catalog No. RP104782 Supplier Invitrogen™ Supplier No. RP104782

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83688. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15.

Specifications

• Accession Number: Q16836
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3033
• Name: Human HADH (aa 133-219) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA409008; AU019341; AW742602; Had; HADH; HADH1; HADHSC; HCDH; HHF4; hydroxyacyl-CoA dehydrogenase; hydroxyacyl-Coenzyme A dehydrogenase; hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; hydroxylacyl-Coenzyme A dehydrogenase short chain; hydroxylacyl-Coenzyme A dehydrogenase, short chain; hydroxylacyl-Coenzyme A dehydrogenase-dehydrogenase; L-3-hydroxyacyl-CoA dehydrogenase; L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain; M/SCHAD; medium and short chain L-3-hydroxyacyl-coenzyme A dehydrogenase; medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; MGC8392; Mschad; SCHAD; short chain 3-hydroxyacyl-CoA dehydrogenase; short-chain 3-hydroxyacyl-CoA dehydrogenase; testis secretory sperm-binding protein Li 203a
• Common Name: HADH
• Gene Symbol: HADH
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining