Invitrogen™ Human Haptoglobin (aa 150-226) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100537	100 μL

Catalog No. RP100537 Supplier Invitrogen™ Supplier No. RP100537

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Haptoglobin is an a2-globulin plasma protein synthesized in the liver. It is an acute phase protein which also acts as a scavenger of hemoglobin from hemolyzed red cells. The haptoglobin monomer consists of two a and two beta chains; the a chains bay be hp1Fa, hp1Sa, or hp2a types while the beta chain is constant. Three major phenotypes are recognized: HP1-1, Hp2-1 and Hp-2-2, in which the hp1a chain bay be either the F or S type.

Specifications

• Accession Number: P00738
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3240
• Name: Human Haptoglobin (aa 150-226) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: alpha polypeptide; Ba1-647; beta polypeptide; binding peptide; Binding peptide (BP); BP; haptoglobin; haptoglobin alpha 1S; Haptoglobin alpha chain; Haptoglobin alpha chain / alpha(1S) beta; haptoglobin alpha(1S)-beta; Haptoglobin alpha(2FS) beta; haptoglobin alpha(2FS)-beta; Haptoglobin beta chain; haptoglobin, alpha polypeptide; haptoglobin, beta polypeptide; haptoglobin; haptoglobin-like; haptoglobin-like; haptoglobin-related protein; Hp; HP-1; HP2 ALPHA2; HP2ALPHA2; HP2-ALPHA-2; HPA1S; HPR; HPT; Liver regeneration-related protein LRRG173; LOC100067869; LOC479668; MGC111141; MGC133752; preHP2; zonulin
• Common Name: Haptoglobin
• Gene Symbol: HP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining