Invitrogen™ Human HAS3 (aa 126-185) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95699	100 μL

Catalog No. RP95699 Supplier Invitrogen™ Supplier No. RP95699

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56780. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HAS1, HAS2 and HAS3 are HA (hyaluronan or hyaluronic acid) synthase proteins. The extracellular matrix in most vertebrates express HA, which is a high molecular weight linear polysaccharide composed of alternating glucuronic acid and N-acetylglucosamine residues linked by b-1,3 and b-1,4 glycosidic bonds. The three HAS genes show distinct patterns of expression during development and their protein products play significantly different roles in the formation of the HA matrix. Both HAS1 and HAS2 synthesize high molecular-weight HA, whereas HAS3 produces lower molecular weight HA. The expression of the three HAS isoforms is more prominent in growing cells than in resting cells and is differentially regulated by various stimuli, suggesting distinct functional roles of the three proteins. HAS3 produces both secreted and cell-associated forms of hyaluronan and is the most active of the three isoforms of this enzyme in adults. HAS3 gene expression plays a crucial role in the regulation of hyaluronan synthesis in the epidermis. Specifically, IFN-g markedly upregulates HAS3 mRNA, whereas TGFbeta downregulates HAS3 transcript levels. The human HAS3 gene maps to chromosome 16q22. 1.

Specifications

• Accession Number: O00219
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3038
• Name: Human HAS3 (aa 126-185) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: HA synthase 3; Has3; Hyaluronan synthase 3; hyaluronate synthase 3; Hyaluronic acid synthase 3
• Common Name: HAS3
• Gene Symbol: HAS3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining