Invitrogen™ Human HDAC4 (aa 371-456) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106197	100 μL

Catalog No. RP106197 Supplier Invitrogen™ Supplier No. RP106197

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone deacetylase 4 (HDAC4) is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3, and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC4 is also involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. It is also involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Mutations to the HDAC4 gene have been found in Brachydactyly-mental retardation syndrome (BDMR).

Specifications

• Accession Number: P56524
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9759
• Name: Human HDAC4 (aa 371-456) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4932408F19Rik; AHO3; AI047285; BDMR; DKFZp779K1053; HA6116; HD4; HD7; HD7b; HD9; HDAC; HDAC4; HDAC-4; HDAC7; HDAC7B; HDAC9; HDAC9B; HDAC9FL; HDACA; HDAC-A; HDRP; Histone deacetylase 4; histone deacetylase A; KIAA0288; KIAA0744; MITR
• Common Name: HDAC4
• Gene Symbol: HDAC4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining