Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human HDAC9 (aa 264-409) Control Fragment Recombinant Protein

Catalog No. RP102464
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102464 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102464 Supplier Invitrogen™ Supplier No. RP102464
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In the intact cell, DNA closely associates with histones and other nuclear proteins to form chromatin. The remodeling of chromatin is a critical component of transcriptional regulation and the acetylation of nucleosomal histones is a major source of this remodeling. Acetylation of lysine residues in the amino terminal tail domain of histone results in an allosteric change in the nucleosomal conformation and an increased accessibility to transcription factors by DNA. Several mammalian proteins function as nuclear histone acetylases, including GCN5, PCAF (p300/CBP-associated factor), p300/CBP, HAT1 and the TFIID subunit TAF II p250. Conversely, the deacetylation of histones is associated with transcriptional silencing. The histone deacetylases (HDAC) include HDAC1-9. HDAC9 and HDAC9a are two alternatively spliced isoforms of HDAC9. HDAC9a is 132 amino acids shorter than HDAC9, but both isoforms contain the HDAC catalytic domain, remain capable of deacetylase activity and repress myoctye enhancer-binding factor 2-mediated transcription. HDAC9 and HDAC9a are expressed in brain, skeletal muscle, kidney, placenta and pancreas.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UKV0
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9734
Name Human HDAC9 (aa 264-409) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AV022454; D030072B18Rik; DKFZp779K1053; HD7; HD7b; HD9; HDAC; HDAC7; Hdac7b; HDAC9; hdac-9; HDAC9B; HDAC9FL; HDRP; histone deacetylase 4/5-related protein; histone deacetylase 7B; Histone deacetylase 9; histone deacetylase-related protein; KIAA0744; MEF-2 interacting transcription repressor (MITR) protein; MEF2-interacting transcription repressor MITR; Mitr; mKIAA0744; RGD1310748; RGD1563092; TWIST
Common Name HDAC9
Gene Symbol Hdac9
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.