Invitrogen™ Human HEF1 (aa 245-330) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104700	100 μL

Catalog No. RP104700 Supplier Invitrogen™ Supplier No. RP104700

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83453. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HEF-1 is a multifunctional protein involved in integrin-based signaling that affects cell motility, growth, apoptosis and oncogenic transformation. The Cas family of docking proteins have been the subject of intense research because of their role in cell motility, growth, apoptosis and oncogenic transformation. These proteins are substrates of focal adhesion kinase (FAK) and the Src family of tyrosine kinases two active targets for drug development. HEF1 protein production increases levels of mRNA transcripts that encode proteins associated with motility, cell transformation and invasiveness, including several metalloproteinases, MLCK, p160ROCK and ErbBi. HEF1 overproduction also mediates apoptosis in epithelial-derived cell lines, including MCF7 and HeLa cells. Recent clinical studies at another institution have found that overexpression of BCAR1 (p130Cas), a related protein, is associated with tamoxifen resistance. This highlights the importance of studying the role of this family of proteins in cancer prognosis.

Specifications

• Accession Number: Q14511
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4739
• Name: Human HEF1 (aa 245-330) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Cas scaffolding protein family member 2; CAS2; CASL; CAS-L; cas-like docking; CASS2; Crk-associated substrate lymphocyte-specific protein; Crk-associated substrate related protein Cas-L; CRK-associated substrate-related protein; dJ49G10.2; dJ761I2.1; Enhancer of filamentation 1; Enhancer of filamentation 1 p55; HEF1; mEF1; Nedd9; NEDD-9; Neural precursor cell expressed developmentally down-regulated protein 9; neural precursor cell expressed, developmentally down-regulated 9; neural precursor cell expressed, developmentally down-regulated gene 9; p105; p130Cas-related protein; renal carcinoma antigen NY-REN-12
• Common Name: HEF1
• Gene Symbol: NEDD9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining