Invitrogen™ Human HENMT1 (aa 1-77) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94398	100 μL

Catalog No. RP94398 Supplier Invitrogen™ Supplier No. RP94398

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55866. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HENMT1 (HEN Methyltransferase 1) is a small RNA methyltransferase gene crucial for the stability and functionality of PIWI-interacting RNAs (piRNAs). It is located in human chromosome 1 at the p36.31 locus. The HENMT1 protein catalyzes the 2'-O-methylation at the 3' end of piRNAs in a Mg2+ dependent manner. This modification is essential for piRNA maturation and stability, ensuring the repression of transposable elements (TEs) during spermatogenesis and maintaining genomic integrity in male germ cells. Studies have highlighted the impact of HENMT1 mutations causing male infertility due to disrupted piRNA pathway and improper germ cell gene regulation. The enzymatic activity of HENMT1 is not only significant for male fertility but is also involved in maintaining piRNA stability in female germ cells, although females with HENMT1 mutations show subfertility.

Specifications

• Accession Number: Q5T8I9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 113802
• Name: Human HENMT1 (aa 1-77) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4921515J06Rik; C1orf59; HEN1; HEN1 methyltransferase homolog 1; HEN1 methyltransferase homolog 1 (Arabidopsis); Henmt1; hua enhancer 1 homolog 1; mHEN1; RGD1306230; Small RNA 2'-O-methyltransferase
• Common Name: HENMT1
• Gene Symbol: HENMT1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining