Invitrogen™ Human Hex (aa 91-163) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106635	100 μL

Catalog No. RP106635 Supplier Invitrogen™ Supplier No. RP106635

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HHEX is a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. Establishes anterior identity at two levels 1) acts early to enhance canonical WNT-signaling by repressing expression of TLE4 and 2) acts later to inhibit NODAL-signaling by directly targeting NODAL.

Specifications

• Accession Number: Q03014
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3087
• Name: Human Hex (aa 91-163) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: hematopoietically expressed homeobox; hematopoietically expressed homeobox, related sequence 2; hematopoietically-expressed homeobox protein Hhex; HEX; Hex1; HHEX; Hhex-rs2; HMPH; homeobox; homeobox protein HEX; Homeobox protein PRH; homeobox, hematopoietically expressed; HOX11L-PEN; mHex; Prh; Prhx; proline-rich homeodomain-containing transcription factor
• Common Name: Hex
• Gene Symbol: HHEX
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining