Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human HEY1 (aa 1-52) Control Fragment Recombinant Protein

Catalog No. RP107238
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107238 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107238 Supplier Invitrogen™ Supplier No. RP107238
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hairy/enhancer-of-split related with YRPW motif protein 1 belongs to the HEY family and is a Notch Signaling Pathway Protein. It contains one basic helix-loop-helix (bHLH) domain and one Orange domain. It is a downstream effector of Notch signaling which may be required for cardiovascular development. It acts as transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. It represses transcription by the cardiac transcriptional activators GATA4 and GATA6. Hey1 is also reported to be expressed during development of the nervous system.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y5J3
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 23462
Name Human HEY1 (aa 1-52) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AI316788; AI414254; basic helix-loop-helix protein OAF1; basic helix-loop-helix transcription factor; BC8; bHLH protein Hesr-1/Hey1; bHLHb31; cardiovascular basic helix-loop-helix factor 2; cardiovascular helix-loop-helix factor 2; CHF2; CHF-2; class B basic helix-loop-helix protein 31; Hairy and enhancer of split-related protein 1; Hairy/E(spl)-related with YRPW motif 1; hairy/enhancer-of-split related with YRPW motif 1; hairy/enhancer-of-split related with YRPW motif protein 1; hairy-related transcription factor 1; Herp1; Herp2; hes related family bHLH transcription factor with YRPW motif 1; Hesr1; HESR-1; hes-related family bHLH transcription factor with YRPW motif 1; HES-related repressor protein 1; HES-related repressor protein 2; HEY1; hey1 protein; hHRT1; HRT1; HRT-1; id:ibd1292; MGC1274; mHRT1; OAF1; zgc:110572
Common Name HEY1
Gene Symbol HEY1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.