Invitrogen™ Human HHLA2 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104087	100 μL

Catalog No. RP104087 Supplier Invitrogen™ Supplier No. RP104087

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

B7-H7 (also known as HHLA2) is a membrane protein with three Ig-like domains (IgV-IgC-IgV), whereas other members of the B7 family generally have only two Ig domains (IgV-IgC). B7-H7 is somewhat more closely related to B7-H3 and B7-H4 and shares 10% to 18% amino acid identity and 23% to 33% similarity to B7 family members. B7-H7 protein is widely expressed in epithelium cells of the gallbladder, breast, kidney, colon, small intestines and placenta. In the immune system, HHLA2 protein is not constitutively expressed on human monocytes/macrophages. B7-H7 is widely expressed in cancers, especially in triple negative breast cancer.

Specifications

• Accession Number: Q9UM44
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 11148
• Name: Human HHLA2 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B7-H5; B7H7; B7-H7; B7y; HERV-H LTR-associating 2; HERV-H LTR-associating protein 2; HHLA2; Human endogenous retrovirus-H long terminal repeat-associating protein 2
• Common Name: HHLA2
• Gene Symbol: HHLA2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IFPLAFFTYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining