Invitrogen™ Human HIP1 (aa 633-772) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90750	100 μL

Catalog No. RP90750 Supplier Invitrogen™ Supplier No. RP90750

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82609. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Huntingtin disease, a neurodegenerate disease, is caused by the expansion of a polymorphic glutamine tract in huntingtin. The Huntingtin Interacting Protein 1 (HIP-1) is a reportedly proapoptotic, cargo-specific adaptor protein that may be involved in the pathogenesis of Huntingtin disease. As well as playing a role in Huntingtin disease, it is likely to be involved in the recruitment of clathrin coats to lipid membranes and it may also factor in tumorigenesis by allowing the survival of precancerous and cancerous cells. Since HIP-1 expression is significantly associated with prostate and colon cancer metastasis, HIP-1 can serve as a putative prognostic factor for prostate and colon cancers.

Specifications

• Accession Number: O00291
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3092
• Name: Human HIP1 (aa 633-772) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610109B09Rik; A930014B11Rik; E130315I21Rik; HIP I; hip1; HIP-1; HIP-I; huntingtin interacting protein 1; huntingtin-interacting protein 1; Huntingtin-interacting protein I; ILWEQ; Kiaa4113; mKIAA4113; SHON; SHONbeta; SHONgamma
• Common Name: HIP1
• Gene Symbol: HIP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QVIQDALNQLEEPPLISCAGSADHLLSTVTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDAIAHGATTCLRAPPEPADSLTEACKQYGRETLAYLASLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining