Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human hnRNP A2B1 (aa 52-188) Control Fragment Recombinant Protein

Catalog No. RP94771
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94771 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94771 Supplier Invitrogen™ Supplier No. RP94771
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81963. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms. [provided by RefSeq, Jul 2008].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P22626
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 3181
Name Human hnRNP A2B1 (aa 52-188) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 9130414A06Rik; DKFZp779B0244; EMBL:BAF79676.1}; FLJ22720; heterogeneous nuclear ribonucleoprotein A2; heterogeneous nuclear ribonucleoprotein A2/B1; heterogeneous nuclear ribonucleoprotein B0a; heterogeneous nuclear ribonucleoprotein B0b; heterogeneous nuclear ribonucleoprotein B1; heterogeneous nuclear ribonucleoproteins A2/B1; heterogeneous nuclear ribonucleoproteins A2/B1 {ECO:0000312; heterogenous nuclear ribonucleoprotein A2/B1; Hnrnp; hnRNP A2 / hnRNP B1; hnRNP A2/B1; hnrnp-A; HNRNPA2; HNRNPA2B1; hnrnpa2b1 {ECO:0000250; HNRNPB1; HNRPA2; HNRPA2B1; HNRPB1; hypothetical protein; IBMPFD2; nuclear ribonucleoprotein particle A2 protein; OTTHUMP00000202465; OTTHUMP00000202466; RNPA2; SNRPB1; UniProtKB:P22626}
Common Name hnRNP A2B1
Gene Symbol HNRNPA2B1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.