Invitrogen™ Human hnRNP U (aa 235-292) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104151	100 μL

Catalog No. RP104151 Supplier Invitrogen™ Supplier No. RP104151

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene.

Specifications

• Accession Number: Q00839
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3192
• Name: Human hnRNP U (aa 235-292) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA408410; AI256620; AL024194; AL024437; AW557595; C1orf199; C86794; FLJ30202; FLJ37978; GRIP120; Heterogeneous nuclear ribonucleoprotein U; heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A); heterogenous nuclear ribonucleoprotein U; hnRNP U; HNRNPU; HNRNPU antisense RNA 1; HNRNPU-AS1; Hnrpu; NCRNA00201; nuclear matrix protein sp120; Nuclear p120 ribonucleoprotein; p120; p120 nuclear protein; pp120; rCG_20317; SAFA; SAF-A; scaffold attachment factor A; Scaffold-attachment factor A; SN1; SP120; system N1 Na+ and H+-coupled glutamine transporter; transporter protein; transporter protein; system N1 Na+ and H+-coupled glutamine transporter; U21.1; U211
• Common Name: hnRNP U
• Gene Symbol: Hnrnpu
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining