Invitrogen™ Human HOXB5 (aa 61-181) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108362	100 μL

Catalog No. RP108362 Supplier Invitrogen™ Supplier No. RP108362

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111191. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Hox proteins are a family of transcription factors that play a role in development and cellular differentiation by regulating downstream target genes. Specifically, the Hox proteins direct DNA-protein and protein-protein interactions that assist in determining the morphologic features associated with the anterior-posterior body axis. Hox proteins are involved in controlling axial patterning, leukemias and hereditary malformations. HoxB5 (homeobox protein Hox-B5), also known as HOX2, HU-1, HOX2A, Hox2.1 or HHO.C10, is a member of the Antp homeobox (Hox) family. It is a 269 amino acid long nuclear protein expressed in the central nervous system. HoxB5 contains one homeobox DNAbinding domain and plays a role in the regulation of lung and gut development, providing cells with positional identities on the anterior-posterior body axis.

Specifications

• Accession Number: P09067
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3215
• Name: Human HOXB5 (aa 61-181) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI385717; HHO.C10; homeo box 2A; homeo box B5; homeobox B5; homeobox protein H24.1; Homeobox protein HHO.C10; homeobox protein Hox-2.1; Homeobox protein Hox-2A; homeobox protein Hox-B5; Homeobox protein Hu-1; homeobox protein Mu-1; HOX2; Hox2.1; Hox-2.1; HOX2A; HOXB5; Hoxb-5; HU-1; RGD1562292
• Common Name: HOXB5
• Gene Symbol: HOXB5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASSSHFGAVGESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining