Invitrogen™ Human HP1 gamma (aa 39-148) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102507	100 μL

Catalog No. RP102507 Supplier Invitrogen™ Supplier No. RP102507

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82181. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane.

Specifications

• Accession Number: Q13185
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 11335
• Name: Human HP1 gamma (aa 39-148) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CBX3; chromobox 3; chromobox homolog 3; chromobox homolog 3 (HP1 gamma homolog, Drosophila); chromobox protein homolog 3; chromobox-like protein 3; HECH; heterochromatin protein 1 gamma; heterochromatin protein 1 homolog gamma; heterochromatin protein HP1 gamma; heterochromatin-like protein 1; HGNC:1553; HP1 gamma; HP1 gamma homolog; HP1g; HP1-GAMMA; HP1Hs-gamma; HPy; M32; Modifier 2 protein; OTTHUMP00000202463
• Common Name: HP1 gamma
• Gene Symbol: Cbx3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining