Invitrogen™ Human HPS3 (aa 91-177) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106416	100 μL

Catalog No. RP106416 Supplier Invitrogen™ Supplier No. RP106416

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111362. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein containing a potential clathrin-binding motif, consensus dileucine signals, and tyrosine-based sorting signals for targeting to vesicles of lysosomal lineage. The encoded protein may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 3. Alternate splice variants exist, but their full length sequence has not been determined.

Specifications

• Accession Number: Q969F9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84343
• Name: Human HPS3 (aa 91-177) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BLOC2S1; coa; cocoa; Cocoa protein; DKFZp686F0413; FLJ22704; Hermansky-Pudlak syndrome 3; Hermansky-Pudlak syndrome 3 homolog (human); Hermansky-Pudlak syndrome 3 protein; Hermansky-Pudlak syndrome 3 protein homolog; hps3; HPS3 biogenesis of lysosomal organelles complex 2 subunit 1; HPS3, biogenesis of lysosomal organelles complex 2 subunit 1; SUTAL; zgc:152969
• Common Name: HPS3
• Gene Symbol: Hps3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YVNWRNKRTENSRVCIRMIGHNVEGPFSKAFRDQMYIIEMPLSEAPLCISCCPVKGDLLVGCTNKLVLFSLKYQIINEEFSLLDFER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining