Invitrogen™ Human HS3ST1 (aa 158-302) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102159	100 μL

Catalog No. RP102159 Supplier Invitrogen™ Supplier No. RP102159

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82007. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site. Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein.

Specifications

• Accession Number: O14792
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9957
• Name: Human HS3ST1 (aa 158-302) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3OST; 3-Ost; 3OST1; 3-OST-1; D5Wsu110e; h3-OST-1; heparan sulfate; heparan sulfate (glucosamine) 3-O-sulfotransferase 1; heparan sulfate 3-O-sulfotransferase 1; heparan sulfate 3-O-sulfotransferase-1; heparan sulfate 3-O-sulfotransferase-1 precursor; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1; Heparan sulfate glucosamine 3-O-sulfotransferase 1; heparan sulfate-glucosamine 3-sulfotransferase 1; heparin-glucosamine 3-O-sulfotransferase; HS3ST1; Hsg3ost
• Common Name: HS3ST1
• Gene Symbol: HS3ST1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining