Invitrogen™ Human HSD17B4 (aa 97-222) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93145	100 μL

Catalog No. RP93145 Supplier Invitrogen™ Supplier No. RP93145

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110873. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxisomal multifunctional enzyme type 2 is a protein that in humans is encoded by the HSD17B4 gene. The protein encoded by this gene is a bifunctional enzyme that is involved in the peroxisomal beta-oxidation pathway for fatty acids. It also acts as a catalyst for the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids. Defects in this gene that affect the peroxisomal fatty acid beta-oxidation activity are a cause of D-bifunctional protein deficiency (DBPD). An apparent pseudogene of this gene is present on chromosome 8. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Specifications

• Accession Number: P51659
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3295
• Name: Human HSD17B4 (aa 97-222) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: (3R)-hydroxyacyl-CoA dehydrogenase; 17[b]-HSD; 17beta-estradiol dehydrogenase type IV; 17-beta-HSD; 17-beta-HSD 4; 17-beta-HSD IV; 17-beta-hydroxysteroid dehydrogenase 4; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase; 4; beta-hydroxyacyl dehydrogenase; beta-keto-reductase; D-3-hydroxyacyl-CoA dehydratase; D-bifunctional protein; D-bifunctional protein, peroxisomal; DBP; Edh17b4; Enoyl-CoA hydratase 2; Hsd17b4; hydroxysteroid (17-beta) dehydrogenase 4; hydroxysteroid 17-beta dehydrogenase 4; hydroxysteroid dehydrogenase 4; MFE-2; MFP2; Mfp-2; MPF-2; Multifunctional protein 2; perMFE-2; peroxisomal multifunctional enzyme type 2; peroxisomal multifunctional enzyme type II; peroxisomal multifunctional protein 2; PRLTS1; SDR8C1; Short chain dehydrogenase/reductase family 8C member 1; short chain dehydrogenase/reductase family 8C, member 1
• Common Name: HSD17B4
• Gene Symbol: HSD17B4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining