Invitrogen™ Human HSF2 (aa 355-460) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102462	100 μL

Catalog No. RP102462 Supplier Invitrogen™ Supplier No. RP102462

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Prokaryotic and eukaryotic cells respond to thermal and chemical stress by inducing a group of genes collectively designated heat shock genes. In eukaryotes, this gene expression is regulated primarily at the transcription level. Heat shock transcription factors (HSF, also designated HSTF) 1 and 2 are involved in this regulation. HSF1 and HSF2 are upregulated by estrogen at both the mRNA and protein level. HSF1 is normally found as a monomer whose transcriptional activity is repressed by constitutive phosphorylation. Upon activation, HSF1 forms trimers, gains DNA binding activity and is translocated to the nucleus. HSF2 activity is associated with differentiation and development, and, like HSF1, binds DNA as a trimer. Both HSF1 and HSF2 are known to be induced by proteasome inhibitors of the ubiquitin pathway.

Specifications

• Accession Number: Q03933
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3298
• Name: Human HSF2 (aa 355-460) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI661205; heat shock factor 2; heat shock factor protein 2; Heat shock transcription factor 2; HSF 2; Hsf2; HSTF 2; HSTF2; MGC117376; MGC156196; MGC75048
• Common Name: HSF2
• Gene Symbol: HSF2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining