Invitrogen™ Human HSP20 (aa 30-81) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98857	100 μL

Catalog No. RP98857 Supplier Invitrogen™ Supplier No. RP98857

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83708. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Heat Shock Protein 20 (HSP20), encoded by the HSPB6 gene, is a member of the small heat shock protein (sHSP) family, prominently involved in cellular stress response and maintenance of cytoskeletal integrity. HSP20 is ubiquitously expressed across various tissues, including cardiac and smooth muscle, where its roles are vital in modulating stress resilience and muscle function. It exerts protective effects against apoptosis and oxidative stress by interacting with cell signaling pathways that enhance cellular survival and protein stabilization. In cardiac muscle, HSP20 is known for its cardioprotective actions during ischemic injury, helping preserve myocardial function by inhibiting hypertrophic signaling pathways and promoting muscle relaxation. Studies highlight its involvement in vasodilation processes, as HSP20 interacts with myosin to regulate smooth muscle contraction and dilatation. Beyond its role in muscle physiology, HSP20 has been investigated for its potential therapeutic applications in cardiovascular diseases and metabolic disorders, where its expression and function could be pivotal in disease modulation and treatment strategies.

Specifications

• Accession Number: O14558
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 126393
• Name: Human HSP20 (aa 30-81) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA387366; cardiac heat shock protein p20; cardiac p20; epididymis luminal protein 55; Gm479; Heat shock 20 kDa-like protein p20; heat shock 20-kDa protein; Heat shock protein; heat shock protein 20kDa; heat shock protein beta-6; heat shock protein family B (small) member 6; heat shock protein family B (small) member B6; heat shock protein, alpha-crystallin-related, B6; HEL55; HSP; HSP20; HSPB6; p20; PPP1R91; protein phosphatase 1, regulatory subunit 91
• Common Name: HSP20
• Gene Symbol: HSPB6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining