Invitrogen™ Human HTR2B (aa 240-326) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90843	100 μL

Catalog No. RP90843 Supplier Invitrogen™ Supplier No. RP90843

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HTR2B is a g-protein coupled receptor for 5-hydroxytryptamine (serotonin). It functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. HTR2B also plays a role in perception of pain, regulation of behavior. It is required to normal proliferation of embryonic cardiac myocytes and normal heart development.

Specifications

• Accession Number: P41595
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3357
• Name: Human HTR2B (aa 240-326) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5-HT 2B receptor; 5-HT(2B); 5-HT2B; 5-HT-2B; 5HT2B Receptor; 5-HT2b receptor; 5-HT-2F; 5-hydroxytryptamine (serotonin) receptor 2B; 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled; 5-hydroxytryptamine 2B receptor; 5-hydroxytryptamine receptor 2B; 5-hydroxytryptamine receptor 2B variant b; AJ012488; AV377389; HTR2B; NP75 protein; serotonin receptor 2B; Srl; Stomach fundus serotonin receptor
• Common Name: HTR2B
• Gene Symbol: HTR2B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining