Invitrogen™ Human ICAD Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92066	100 μL

Catalog No. RP92066 Supplier Invitrogen™ Supplier No. RP92066

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ICAD is the inhibitor of caspase-3-activated DNase which is a substrate that controls nuclear apoptosis. ICAD has two isoforms: a functional isoform of 45kDa, ICAD-L/DNA fragmentation factor (DFF) 45; and a 35kDa isoform, ICAD-S/DFF35. Although both ICAD-L and ICAD-S can bind and inhibit CAD, only ICAD-L was reported to be functional. ICAD is cleaved to be inactivated and allow caspase-activated DNase (CAD) to execute nuclear internucleosomal apoptotic DNA fragmentation. In non-apoptotic cells, CAD is complexed with its inhibitor, ICAD. The activation of the CAD/ICAD complex occurs through the caspase 3-mediated cleavage of ICAD at residues 117 and 224, which results in three ICAD fragments that are then released from CAD. In addition to its DNase inhibitory activity, ICAD acts as a CAD specific folding chaperone. There are recent reports that ICAD is a potential target for restoring a normal apoptotic signal transduction pathway in colon and brain cancer cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for the ICAD gene.

Specifications

• Accession Number: O00273
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1676
• Name: Human ICAD Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A330085O09Rik; DFF; DFF1; DFF35; Dff45; DFF-45; Dffa; DNA fragmentation factor 45 kDa subunit; DNA fragmentation factor subunit alpha; DNA fragmentation factor, 45kDa, alpha polypeptide; DNA fragmentation factor, alpha subunit; H13; ICAD; ICAD-L; ICAD-S; Inhibitor of CAD; RP23-121D17.3
• Common Name: ICAD
• Gene Symbol: DFFA
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRQSCAIVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining