Invitrogen™ Human IDH1 (aa 340-412) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96104	100 μL

Catalog No. RP96104 Supplier Invitrogen™ Supplier No. RP96104

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production.

Specifications

• Accession Number: O75874
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3417
• Name: Human IDH1 (aa 340-412) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI314845; AI788952; cb876; corneal epithelial crystallin; cytosolic NADP+-dependent isocitrate dehydrogenase; cytosolic NADP-isocitrate dehydrogenase; cytosolic NADP-isocitrate dehydrongenase; E030024J03Rik; epididymis luminal protein 216; epididymis secretory protein Li 26; fm90e09; HEL-216; HEL-S-26; ICDH; Id-1; IDCD; IDH; Idh1; Idh-1; IDP; Idpc; im:7143416; isocitrate dehydrogenase (NAD(+)) IDH1; isocitrate dehydrogenase (NADP(+)) 1; isocitrate dehydrogenase (NADP(+)) 1, cytosolic; Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial; Isocitrate dehydrogenase [NADP] cytoplasmic; isocitrate dehydrogenase 1 (NADP+); isocitrate dehydrogenase 1 (NADP+), soluble; Isocitrate dehydrogenase 1, soluble; Isocitric dehydrogenase; N2690; NAD(+)-specific ICDH; NADP(+)-specific ICDH; NADP+-specific ICDH; NADP-cICDH; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; OTTHUMP00000206464; OTTHUMP00000206465; OTTHUMP00000206466; oxalosuccinate decarboxylase; PICD; wu:fm90e09; YNL037C
• Common Name: IDH1
• Gene Symbol: IDH1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining