Invitrogen™ Human IFI35 (aa 16-87) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109490	100 μL

Catalog No. RP109490 Supplier Invitrogen™ Supplier No. RP109490

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Interferon-Induced Protein 35 (IFI35), encoded by the IFI35 gene, is located on chromosome 17 and is recognized for its role in immune response modulation, especially under viral stress conditions. Structurally, IFI35 is part of a complex regulatory network that influences non-canonical NF-kB signaling. This process involves the proteasomal processing of p105 into the DNA-binding transcription factor p50, which forms a heterodimer with RELB (RELB/p50) to activate cell chemotaxis autonomously. The gene's dynamic expression under viral stress has been linked to various immune regulatory networks and is crucial for immune cell recruitment and maintenance, particularly M2-like tumor-associated macrophages (TAMs) within the tumor microenvironment. IFI35 upregulation is significant in conditions of neuroinflammation and multiple sclerosis, especially in patients treated with interferons (IFN), indicating its potential as a biomolecular marker. Additionally, IFI35's role in triple-negative breast cancer highlights its impact on antitumor immunity, where its ablation enhances the infiltration of effector CD8+ T cells and sensitizes tumors to anti-PD-1 immunotherapy. This positions IFI35 as a key player in both immune response and cancer treatment strategies.

Specifications

• Accession Number: P80217
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3430
• Name: Human IFI35 (aa 16-87) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2010008K16Rik; AW986054; IFI35; ifi-35; IFP 35; IFP35; interferon induced protein 35; interferon-induced 35 kDa protein; Interferon-induced 35 kDa protein homolog; interferon-induced protein 35
• Common Name: IFI35
• Gene Symbol: IFI35
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining