Invitrogen™ Human IFI44 (aa 111-194) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94246	100 μL

Catalog No. RP94246 Supplier Invitrogen™ Supplier No. RP94246

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55525. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IFI-44 (interferon-induced protein 44), also known as p44 or MTAP44 (microtubule-associated protein 44), is a 444 amino acid protein that localizes to the cytoplasm and, upon induction by IFN-βs, aggregates to form microtubular structures. Human IFI-44 shares 97% sequence similarity with its chimp counterpart, suggesting a conserved role between species. The gene encoding IFI-44 maps to human chromosome 1, which spans 260 million base pairs, contains over 3,000 genes and comprises nearly 8% of the human genome. Chromosome 1 houses a large number of disease-associated genes, including those that are involved in familial adenomatous polyposis, Stickler syndrome, Parkinson's disease, Gaucher disease, schizophrenia and Usher syndrome.

Specifications

• Accession Number: Q8TCB0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10561
• Name: Human IFI44 (aa 111-194) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A430056A10Rik; AW261460; Ifi44; interferon induced protein 44; interferon-induced protein 44; interferon-induced, hepatitis C-associated microtubular aggregate protein (44kD); microtubule-associated protein 44; Mtap44; p44; TBC/LysM-associated domain containing 5; TLDC5
• Common Name: IFI44
• Gene Symbol: IFI44
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining