Invitrogen™ Human IFIT5 (aa 304-381) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105225	100 μL

Catalog No. RP105225 Supplier Invitrogen™ Supplier No. RP105225

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66464. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Interferon-induced RNA-binding protein involved in the human innate immune response. Has a broad and adaptable RNA structure recognition important for RNA recognition specificity in antiviral defense. Binds precursor and processed tRNAs as well as poly-U-tailed tRNA fragments (PubMed:25092312, PubMed:23317505, PubMed:23774268). Specifically binds single-stranded RNA bearing a 5'-triphosphate group (PPP-RNA), thereby acting as a sensor of viral single-stranded RNAs. Single-stranded PPP-RNAs, which lack 2'-O-methylation of the 5' cap and bear a 5'-triphosphate group instead, are specific from viruses, providing a molecular signature to distinguish between self and non-self mRNAs by the host during viral infection. Directly binds PPP-RNA in a non-sequence-specific manner (PubMed:23334420). Also recognizes and selectively binds AT-rich dsDNA (PubMed:23774268). Additionally, as a mediator in innate immunity, regulates positively IKK-NFKB signaling by sinergizing the recruitment of IKK to MAP3K7 (PubMed:26334375). [UniProt].

Specifications

• Accession Number: Q13325
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 24138
• Name: Human IFIT5 (aa 304-381) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: IFIT5; IFIT-5; interferon induced protein with tetratricopeptide repeats 5; interferon-induced 58 kDa protein; Interferon-induced protein with tetratricopeptide repeats 5; ISG58; P58; Retinoic acid- and interferon-inducible 58 kDa protein; retinoic acid- and interferon-inducible protein (58kD); RI58
• Common Name: IFIT5
• Gene Symbol: IFIT5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: THNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDIFRKALRLENITDDHKHQIHYH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining