Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human IFITM3 (aa 1-57) Control Fragment Recombinant Protein

Catalog No. RP101079
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101079 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101079 Supplier Invitrogen™ Supplier No. RP101079
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IFITM3 (interferon induced transmembrane protein 3), also known as 1-8U or IP15, is a multi-pass membrane protein that belongs to the IFITM (interferon inducible transmembrane) family of proteins. IFITM proteins are induced by type I and type II interferons and contain multiple interferon (IFN)-stimulated response elements (ISREs) in their promoter regions. IFITM proteins play important roles in many cellular processes and their expression requires the presence of the chromatin remodeling SWI/SNF-like BAF complexes. Cellular processes involving IFITM proteins include cellular anti-proliferative activities and homotypic cell adhesion functions of interferons. In addition, IFITM genes are often upregulated in various cancer cells, suggesting a possible role in carcinogenesis. Localizing to the membrane, IFITM3 is a 133 amino acid protein that is induced by IFN-alpha and IFN-gamma. IFITM3 expression can be regulated by TEF-1, Brg-1 and Sp1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q01628
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10410
Name Human IFITM3 (aa 1-57) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1110004C05Rik; 1-8U; Cd225; Cdw217; Dispanin subfamily A member 2b; DSPA2b; Fgls; Fragilis; Fragilis 3; Fragilis protein; Ifitm3; ifitm-like protein 1; interferon induced transmembrane protein 3; interferon-induced transmembrane protein 3; interferon-inducible protein 15; Interferon-inducible protein 1-8U; interferon-inducible protein variant 10; IP15; mil-1; Mouse ifitm-like protein 1; rat8
Common Name IFITM3
Gene Symbol IFITM3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.