Invitrogen™ Human IGF2R (aa 161-291) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102439	100 μL

Catalog No. RP102439 Supplier Invitrogen™ Supplier No. RP102439

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lysosomal enzymes containing one or two mannose 6-phosphate (man6P) moieties are moved about in the cell by two distinct but interconnected cycles by means of approximately 300 kDa cation independent mannose 6-phospate receptors (CI-MPR). The biosynthetic cycle refers to the MPR transport of newly synthesized lysosomal enzymes from the trans Golgi network to late endosomes or early lysosomes. The endocytic cycle transports extracellular lysosomal enzymes from the plasma membrane via clathrin-coated vesicles to early endosomes. The entire pool of MPRs cycles between these cellular compartments every 3 hours. The steady state distribution of MPR's is predominantly within late endosomes, fewer in the trans Golgi network and approximately 10 % at cell surface. In addition to its man6P binding activity, the MPR contains a separate binding site for the type II insulin-like growth factor and is capable of binding both man6P and IGF-II simultaneously. An approximately 240 kDa soluble, truncated form, representing the extracellular domain of the protein, has also been found circulating in serum and is capable of binding both ligands.

Specifications

• Accession Number: P11717
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3482
• Name: Human IGF2R (aa 161-291) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 300 kDa mannose 6-phosphate receptor; AI661837; cation-independent mannose 6-phosphate receptor; cation-independent mannose 6-phosphate receptor protein; cation-independent mannose-6-phosphate receptor; cation-independent MPR; CD222; CI Man-6-P receptor; CI-M6PR; CIMPR; CI-MPR; Igf2r; IGF-II receptor; IGF-II/CI-MPR; Igfr2; insulin like growth factor 2 receptor; insulin-like growth factor 2 receptor; Insulin-like growth factor II receptor; insulin-like growth factor receptor type 2; M6P; M6P/IGF2 receptor; M6P/IGF2R; M6PR; M6P-R; mannose-6-phosphate receptor, cation independent; mannose-6-phosphate/insulin-like growth factor II receptor; MPR 300; MPR1; MPR300; MPRI; similar to mannose-6-phosphate/insulin-like growth factor II receptor
• Common Name: IGF2R
• Gene Symbol: IGF2R
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining