Invitrogen™ Human IGFBP4 (aa 164-258) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103628	100 μL

Catalog No. RP103628 Supplier Invitrogen™ Supplier No. RP103628

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111612. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the insulin-like growth factor binding protein family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.

Specifications

• Accession Number: P22692
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3487
• Name: Human IGFBP4 (aa 164-258) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI875747; Band 3A; BP-4; Deb2; differentially expressed in B16F10 2; HT29-IGFBP; IBP4; IBP-4; IGF-binding protein 4; IGFBP; Igfbp4; IGF-BP4; IGFBP-4; Insulin like growth factor binding protein; insulin like growth factor binding protein 4; insulin-like growth factor binding protein 4; insulin-like growth factor binding protein-4; insulin-like growth factor-binding protein 4; insulin-like growth factor-binding protein-4; LOW QUALITY PROTEIN: insulin-like growth factor-binding protein 4
• Common Name: IGFBP4
• Gene Symbol: IGFBP4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining