Invitrogen™ Human IKK beta (aa 296-435) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99395	100 μL

Catalog No. RP99395 Supplier Invitrogen™ Supplier No. RP99395

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81927. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphorylation of serine residues on the I-kappa-B proteins by IKK kinases, including IKBKB, marks them for destruction via the ubiquitination pathway, allowing activation of the NF-kappa-B complex. Inhibitor of nuclear factor kappa-B kinase subunit beta (IKK beta) is a serine kinase that plays an essential role in the NF-kaapa-B signaling pathway which is activated by mulitple stimuli such as inflammatory cytokines, bacterial, or viral products, DNA damages, or other cellular stresses. IKK beta acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Mutations affecting the IKK beta gene can result in Immunodeficiency 15 (IMD15).

Specifications

• Accession Number: O14920
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3551
• Name: Human IKK beta (aa 296-435) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI132552; AIM-1; FLJ40509; I-kappa-B kinase 2; I-kappa-B-kinase beta; Ikbkb; IKK[b]; IKK2; IKK-2; IKKB; IKK-B; IKKbeta; IKK-beta; IMD15; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of kappaB kinase beta; inhibitor of nuclear factor kappa B kinase beta subunit; inhibitor of nuclear factor kappa-B kinase subunit beta; MGC131801; NFKBIKB; nuclear factor NF-kappa-B inhibitor kinase beta
• Common Name: IKK beta
• Gene Symbol: Ikbkb
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining