Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Human IL17RD Partial ORF (NP_060033, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Quantity:
10 μg
25 μg
Description
Fibroblast growth factors (FGFs; see MIM 603726) are secreted proteins involved in cellular proliferation, migration, differentiation, and survival. FGF activity is negatively regulated by members of the 'sprouty' family (e.g., SPRY1, MIM 602465). The SEF protein is a modulator of FGF signaling.[supplied by OMIM]
Sequence: MESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKR
Specifications
Specifications
Accession Number | NP_060033 |
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 54756 |
Molecular Weight (g/mol) | 36.74kDa |
Name | IL17RD (Human) Recombinant Protein (Q01) |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quantity | 25 μg |
Immunogen | MESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKR |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction