Invitrogen™ Human IL20RB (aa 162-229) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108495	100 μL

Catalog No. RP108495 Supplier Invitrogen™ Supplier No. RP108495

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84623. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).[supplied by OMIM, Feb 2009].

Specifications

• Accession Number: Q6UXL0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 53833
• Name: Human IL20RB (aa 162-229) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AV228068; DIRS1; Fibronectin type III domain containing 6; FNDC6; Gm186; IL-20 receptor subunit beta; IL20R2; IL-20R2; IL20RB; IL-20RB; IL-20R-beta; interleukin 20 receptor beta; interleukin 20 receptor beta subunit; interleukin 20 receptor subunit beta; interleukin-20 receptor II; interleukin-20 receptor subunit beta; RGD1566151; UNQ557/PRO1114
• Common Name: IL20RB
• Gene Symbol: Il20rb
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining