Invitrogen™ Human ING4 (aa 113-182) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95605	100 μL

Catalog No. RP95605 Supplier Invitrogen™ Supplier No. RP95605

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111030, PA5-111452. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ING4 gene belongs to the ING (Inhibitor of Growth) family of tumor suppressors. All five members of the ING protein family identified to date contain a highly conserved plant homeodomain (PHD) finger motif at the C-terminal end, which is found in transcription factors that modulate chromatin structure. ING proteins have been shown to form transcriptional complexes leading to activation of responsive genes that mediate a wide range of cellular functions, including growth arrest, DNA repair, gene transcription, apoptosis, and senescence. The candidate tumor suppressor ING4 has a role in brain tumor pathogenesis, and is involved in regulating tumor growth and angiogenesis. Expression of ING4 is reduced in gliomas compared to normal brain tissue, and ING4 reduction correlates with progression from lower to higher grades of tumors. ING4 physically interacts with the p65 (RelA) subunit of NF-kB and represses transcription of NF-kB responsive genes. Inactivating mutations in ING4 transcripts have been described in various human cancer cell lines, and deletion of the ING4 locus has been detected in 10-20% of human breast cancer cell lines and tumors.

Specifications

• Accession Number: Q9UNL4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51147
• Name: Human ING4 (aa 113-182) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: brain my036 protein; candidate tumor suppressor p33 ING1 homolog; D6Wsu147e; D6Xrf92; ING1-like protein; Ing4; inhibitor of growth family member 4; inhibitor of growth family, member 4; inhibitor of growth protein 4; My036; p29ING4
• Common Name: ING4
• Gene Symbol: ING4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining