Invitrogen™ Human INTS6 (aa 672-815) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95936	100 μL

Catalog No. RP95936 Supplier Invitrogen™ Supplier No. RP95936

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51643 (PA5-51643. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. INTS6 is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH). DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH). Three transcript variants encoding two different isoforms have been found for this gene.

Specifications

• Accession Number: Q9UL03
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26512
• Name: Human INTS6 (aa 672-815) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900075H24Rik; AI480962; Dbi1; DBI-1; Ddx26; DDX26A; DEAD box protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26; DICE1; DKFZP434B105; HDB; INT6; integrator complex subunit 6; INTS6; LRRGT00024; Notch2l; Notchl2; Protein DDX26; Protein deleted in cancer 1; RNA helicase HDB
• Common Name: INTS6
• Gene Symbol: INTS6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining