Invitrogen™ Human IP6K2 (aa 73-140) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108575	100 μL

Catalog No. RP108575 Supplier Invitrogen™ Supplier No. RP108575

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The members of the inositol hexakisphosphate kinase family, IP6K1 and IP6K2, have a high affinity and selectivity for inositol hexakisphosphate (InsP6) as a substrate. IP6K1 and IP6K2 (also designated PiUS) convert InsP6 to PP-InsP5. However, neither kinase demonstrates any catalytic activity with other inositol pyrophosphates. The presence of InsP6, which inhibits serine/threonine protein phosphatases, increases the influx of calcium across the plasma membrane and implies that it may mediate the regulation of insulin exocytosis. IP6K1 was purified as a 54 kDa protein in rat brain extracts. By homology, IP6K1 and IP6K2 were characterized in mouse as a 50 kDa and 49 kDa protein, respectively. IP6K1 displays ATP synthase activity by transferring a phosphate from PP-InsP5 to ADP, which suggests a role for the IP6 kinases as high energy phosphate donors.

Specifications

• Accession Number: Q9UHH9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51447
• Name: Human IP6K2 (aa 73-140) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1500005N04Rik; ATP:1D-myo-inositol-hexakisphosphate phosphotransferase; AW050208; Ihpk2; Inositol hexakisphosphate kinase 2; inositol hexaphosphate kinase 2; inositol-hexakisphosphate kinase; insp6 kinase 2; IP6 Kinase; IP6K2; P(i)-uptake stimulator; pi uptake stimulator; Pius; TCCCIA00113
• Common Name: IP6K2
• Gene Symbol: Ip6k2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining