Invitrogen™ Human IQCC (aa 367-466) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94346	100 μL

Catalog No. RP94346 Supplier Invitrogen™ Supplier No. RP94346

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55915. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The IQCC (IQ Motif Containing C) gene encodes a protein that contains the IQ motif, which is known for its role in binding calmodulin and other proteins with EF-hand calcium-binding motifs. IQCC is located on chromosome 6 at position 6q16.1. The IQCC protein is involved in several cellular processes, including signaling pathways related to intracellular calcium levels and regulation of ion channels. Additionally, recent studies have indicated its potential involvement in cancer biology, where disruptions in its expression or function may contribute to tumorigenesis. The exact molecular mechanisms and pathways influenced by IQCC are still under investigation, and elucidating these aspects could uncover new therapeutic targets for various diseases, including cancer.

Specifications

• Accession Number: Q4KMZ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55721
• Name: Human IQCC (aa 367-466) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BC026978; IQ domain-containing protein C; IQ motif containing C; Iqcc; RP4-622L5.6
• Common Name: IQCC
• Gene Symbol: IQCC
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTVRTQELGLSEDHIIWDGTLGGPEHSVLDLWRTKPPKGQAPTDRSSRDGTSNEPSHEGQKKQRTIPWRSKSPEILSSTKAGCTGEEQWRGRPWKTEPPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining