Invitrogen™ Human IRAK1 (aa 14-104) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103186	100 μL

Catalog No. RP103186 Supplier Invitrogen™ Supplier No. RP103186

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IL-1 receptor associated kinases (IRAKs) are serine/threonine kinases involved in signaling via Toll/IL-1 pathways. It is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation. IRAK's association with MYD88 leads to IRAK1 phosphorylation by IRAK4 and subsequent autophosphorylation and kinase activation. Alternatively, IRAK1 can phosphorylate TIRAP to promote its ubiquitination and subsequent degradation. IRAK1 also phosphorylates the interferon regulatory factor 7 (IRF7) to induce its activation and translocation to the nucleus. This results in the transcriptional activiation of type I IFN genes, which drive the cell in an antiviral state.

Specifications

• Accession Number: P51617
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3654
• Name: Human IRAK1 (aa 14-104) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA408924; Il1rak; interleukin 1 receptor associated kinase 1; interleukin-1 receptor-associated kinase 1; interleukin-1 receptor-associated kinase-1; IRAK; Irak1; IRAK-1; IRAK1-S; mPLK; pelle; Pelle homolog; pelle-like protein kinase; Plpk; RGD1563841
• Common Name: IRAK1
• Gene Symbol: Irak1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining