Invitrogen™ Human IREB2 (aa 377-448) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104254	100 μL

Catalog No. RP104254 Supplier Invitrogen™ Supplier No. RP104254

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64388. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Iron regulatory protein 2 (IRP2) is a central post-transcriptional regulator of cellular and systemic iron metabolism. It is a cytosolic RNA-binding protein that binds to stem-loop structures. IRP2 is regulated by iron-mediated proteolysis. Hypoxia is important for normal tissue physiology as well as being a component of several pathophysiological conditions, including heart and cerebrovascular diseases and tumor growth. Because iron and oxygen are closely related, IRP2 also plays a role during hypoxia (low oxygen).

Specifications

• Accession Number: P48200
• Concentration: 5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3658
• Name: Human IREB2 (aa 377-448) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ACO3; D9Ertd85e; FLJ23381; im:7153062; Ireb2; IRE-BP 2; IREBP2; Iron regulatory protein 2; iron responsive element binding protein 2; iron-regulatory protein 2; iron-responsive element binding protein 2; iron-responsive element-binding protein 2; Iron-responsive element-binding protein 2-like protein; IRP2; IRP2AD
• Common Name: IREB2
• Gene Symbol: IREB2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRNDQNSSGEPEYSQVIQINLNSIVPSVSGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining