Invitrogen™ Human IRF3 (aa 27-169) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102261	100 μL

Catalog No. RP102261 Supplier Invitrogen™ Supplier No. RP102261

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82178. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IFR3 (interferon regulatory factor 3) is a key transcriptional regulator of type I interferon (IFN)-dependent immune responses. It plays a critical role in the innate immune response against DNA and RNA viruses. IFR3 regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters. It acts as a more potent activator of the IFN-beta gene than the IFN-alpha gene and plays a critical role in both the early and late phases of the IFNA/B gene induction. IFR3 is found in an inactive form in the cytoplasm of uninfected cells and following viral infection, double-stranded RNA, or toll-like receptor signaling. It is phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization and nuclear localization and association with CREB binding protein to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of the type I IFN and ISG genes. Mutations in the gene can result in encephalopathy, acute, infection-induced, herpes-specific 7.

Specifications

• Accession Number: Q14653
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3661
• Name: Human IRF3 (aa 27-169) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C920001K05Rik; IIAE7; Interferon regulatory factor 3; IRF3; IRF-3; IRF3 (phospho S386); IRF3 (pS386); IRF3 (pSer386); IRF3 phospho; IRF3 phospho S386; IRF3 phospho Ser386; phospho IRF3
• Common Name: IRF3
• Gene Symbol: IRF3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining