Invitrogen™ Human IRG1 (aa 177-266) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109751	100 μL

Catalog No. RP109751 Supplier Invitrogen™ Supplier No. RP109751

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144875. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in the inhibition of the inflammatory response. Acts as a negative regulator of the Toll-like receptors (TLRs)- mediated inflammatory innate response by stimulating the tumor necrosis factor alpha-induced protein TNFAIP3 expression via reactive oxygen species (ROS) in LPS-tolerized macrophages. Involved in antimicrobial response of innate immune cells; IRG1- mediated itaconic acid production contributes to the antimicrobial activity of macrophages. Plays a role in the embryo implantation.

Specifications

• Accession Number: A6NK06
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 730249
• Name: Human IRG1 (aa 177-266) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ACOD1; Aconitate decarboxylase; aconitate decarboxylase 1; CAD; Cis-aconitate decarboxylase; cis-aconitic acid decarboxylase; Immune-responsive gene 1 protein; immune-responsive gene 1 protein homolog; immunoresponsive 1 homolog; IRG1
• Common Name: IRG1
• Gene Symbol: ACOD1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGLSSTKCREALAIAVSHAGAPMANAATQTKPLHIGNAAKHGIEAAFLAMLGLQGNKQVLDLEAGFGAFYANYSPKVLPSIASYSWLLDQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining